PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_13699.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 313aa    MW: 35236.5 Da    PI: 9.9252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_13699.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-1677122147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw + 
  Rsa1.0_13699.1_g00001.1  77 RGHWRPTEDAKLKELVAQFGPQNWNLIAHHLL-GRSGKSCRLRWCNQ 122
                              899****************************9.***********985 PP

2Myb_DNA-binding52.51.1e-16129173147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++++T+eE+ +l+ a++ +G++ W++I++ ++ gRt++ +k++w+ +
  Rsa1.0_13699.1_g00001.1 129 KNAFTEEEESRLLTAHRAYGNK-WSLISHLFP-GRTDNAVKNHWHVV 173
                              679*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.00172123IPR017930Myb domain
SMARTSM007172.9E-1476125IPR001005SANT/Myb domain
SuperFamilySSF466893.56E-2877170IPR009057Homeodomain-like
PfamPF002491.1E-1577122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2578130IPR009057Homeodomain-like
CDDcd001673.85E-1380121No hitNo description
PROSITE profilePS5129424.155124178IPR017930Myb domain
SMARTSM007171.1E-14128176IPR001005SANT/Myb domain
PfamPF002491.8E-14129172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-20131176IPR009057Homeodomain-like
CDDcd001673.24E-11131174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MNLKLSVKVQ TGNKTIKLSR RFEEANNFGS PPNSHTDFSL ARNHLHNKSY SVLERGENEN  60
GLKRRGNNGM KTKLCSRGHW RPTEDAKLKE LVAQFGPQNW NLIAHHLLGR SGKSCRLRWC  120
NQLDPRINKN AFTEEEESRL LTAHRAYGNK WSLISHLFPG RTDNAVKNHW HVVMARRTRV  180
SQRQQPLHPP SVNAGMTVSS SCRYNNGGFF GRVGEGTLVN EADDDDGSAV STCTTELSLT  240
PPSSTHQPLF LHDDYTLASG KDGQCAQRAE VNGICSKKMD HQNRHTTTVS EREVEMKMKS  300
GFYFFDFLGV GVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32771787108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009131611.10.0PREDICTED: transcription factor MYB23-like
TrEMBLM4CQD30.0M4CQD3_BRARP; Uncharacterized protein
STRINGBra006422.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-144myb domain protein 56